Loading...
Statistics
Advertisement

Best Insurance For DUI | Staying On The Road
www.bestinsurancefordui.com/

Bestinsurancefordui.com

Advertisement
Bestinsurancefordui.com is hosted in United States / Lansing . Bestinsurancefordui.com uses HTTPS protocol. Number of used technologies: 9. First technologies: CSS, Flexslider, Google Font API, Number of used javascripts: 17. First javascripts: Jquery-1.6.4.min.js, Modernizr.js, Superfish.js, Number of used analytics tools: 0. Its server type is: Apache/2.2.26 (Unix) mod_ssl/2.2.26 OpenSSL/1.0.1e-fips mod_bwlimited/1.4. Its CMS is: Wordpress.

Technologies in use by Bestinsurancefordui.com

Technology

Number of occurences: 9
  • CSS
  • Flexslider
  • Google Font API
  • Html
  • Html5
  • Javascript
  • Php
  • Pingback
  • SuperFish

Advertisement

Javascripts

Number of occurences: 17
  • jquery-1.6.4.min.js
  • modernizr.js
  • superfish.js
  • jquery.easing.1.3.js
  • jquery.prettyPhoto.js
  • jquery.flexslider.js
  • jquery.tools.min.js
  • jquery.mobilemenu.js
  • jquery.elastislide.js
  • jquery.loader.js
  • swfobject.js
  • slides.jquery.js
  • jquery.twitter.js
  • jquery.flickrush.js
  • audio.js
  • custom.js
  • comment-reply.js

Content Management System

Number of occurences: 1
  • Wordpress

Server Type

  • Apache/2.2.26 (Unix) mod_ssl/2.2.26 OpenSSL/1.0.1e-fips mod_bwlimited/1.4

Powered by

  • PHP/5.3.27

Conversion rate optimization

visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Bestinsurancefordui.com

SSL certificate

    • name: /OU=Domain Control Validated/CN=*.liquidweb.com
    • subject:
      • OU: Domain Control Validated
      • CN: *.liquidweb.com
    • hash: 3d2655d4
    • issuer:
      • C: BE
      • O: GlobalSign nv-sa
      • CN: GlobalSign Domain Validation CA - SHA256 - G2
    • version: 2
    • serialNumber: 1492252041277996901976193579034130263869160
    • validFrom: 140415171337Z
    • validTo: 190415171337Z
    • validFrom_time_t: 1397582017
    • validTo_time_t: 1555348417
    • extensions:
      • keyUsage: Digital Signature, Key Encipherment
      • certificatePolicies: Policy: 2.23.140.1.2.1 CPS: https://www.globalsign.com/repository/
      • subjectAltName: DNS:*.liquidweb.com, DNS:liquidweb.com
      • basicConstraints: CA:FALSE
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • crlDistributionPoints: Full Name: URI:http://crl.globalsign.com/gs/gsdomainvalsha2g2.crl
      • authorityInfoAccess: CA Issuers - URI:http://secure.globalsign.com/cacert/gsdomainvalsha2g2r1.crt OCSP - URI:http://ocsp2.globalsign.com/gsdomainvalsha2g2
      • subjectKeyIdentifier: 4B:E0:75:59:51:0A:19:A0:18:EC:F0:CB:AB:41:CD:35:B6:31:97:BA
      • authorityKeyIdentifier: keyid:EA:4E:7C:D4:80:2D:E5:15:81:86:26:8C:82:6D:C0:98:A4:CF:97:0F

Meta - Bestinsurancefordui.com

Number of occurences: 3
  • Name:
    Content: article
  • Name: viewport
    Content: width=device-width,initial-scale=1.0
  • Name: generator
    Content: WordPress 3.4.2

Server / Hosting

  • IP: 67.225.255.244
  • Latitude: 42.73
  • Longitude: -84.64
  • Country: United States
  • City: Lansing

Rname

  • ns44.domaincontrol.com
  • ns43.domaincontrol.com
  • smtp.secureserver.net
  • mailstore1.secureserver.net

Target

  • dns.jomax.net

HTTP Header Response

HTTP/1.1 301 Moved Permanently Date: Tue, 26 Apr 2016 03:08:08 GMT Server: Apache/2.2.26 (Unix) mod_ssl/2.2.26 OpenSSL/1.0.1e-fips mod_bwlimited/1.4 X-Powered-By: PHP/5.3.27 X-Pingback: http://www.bestinsurancefordui.com/xmlrpc.php Location: http://www.bestinsurancefordui.com/ Connection: close Content-Type: text/html; charset=UTF-8 HTTP/1.1 200 OK Date: Tue, 26 Apr 2016 03:08:08 GMT Server: Apache/2.2.26 (Unix) mod_ssl/2.2.26 OpenSSL/1.0.1e-fips mod_bwlimited/1.4 X-Powered-By: PHP/5.3.27 X-Pingback: http://www.bestinsurancefordui.com/xmlrpc.php Connection: close Content-Type: text/html; charset=UTF-8

DNS

host: bestinsurancefordui.com
  1. class: IN
  2. ttl: 3600
  3. type: A
  4. ip: 67.225.255.244
host: bestinsurancefordui.com
  1. class: IN
  2. ttl: 3600
  3. type: NS
  4. target: ns44.domaincontrol.com
host: bestinsurancefordui.com
  1. class: IN
  2. ttl: 3600
  3. type: NS
  4. target: ns43.domaincontrol.com
host: bestinsurancefordui.com
  1. class: IN
  2. ttl: 3600
  3. type: SOA
  4. mname: ns43.domaincontrol.com
  5. rname: dns.jomax.net
  6. serial: 2012111600
  7. refresh: 28800
  8. retry: 7200
  9. expire: 604800
  10. minimum-ttl: 3600
host: bestinsurancefordui.com
  1. class: IN
  2. ttl: 3600
  3. type: MX
  4. pri: 0
  5. target: smtp.secureserver.net
host: bestinsurancefordui.com
  1. class: IN
  2. ttl: 3600
  3. type: MX
  4. pri: 10
  5. target: mailstore1.secureserver.net
host: bestinsurancefordui.com
  1. class: IN
  2. ttl: 3600
  3. type: TXT
  4. txt: google-site-verification=AQEPfPnEox4dAVP71-XK1iOjVWPjSTR2ZQOXAMamPlk
  5. entries: Array

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.estinsurancefordui.com, www.bqestinsurancefordui.com, www.qestinsurancefordui.com, www.bwestinsurancefordui.com, www.westinsurancefordui.com, www.bzestinsurancefordui.com, www.zestinsurancefordui.com, www.bxestinsurancefordui.com, www.xestinsurancefordui.com, www.bestinsurancefordui.com, www.estinsurancefordui.com, www.bsestinsurancefordui.com, www.sestinsurancefordui.com, www.byestinsurancefordui.com, www.yestinsurancefordui.com, www.beestinsurancefordui.com, www.eestinsurancefordui.com, www.bdestinsurancefordui.com, www.destinsurancefordui.com, www.bcestinsurancefordui.com, www.cestinsurancefordui.com, www.bstinsurancefordui.com, www.bexstinsurancefordui.com, www.bxstinsurancefordui.com, www.besstinsurancefordui.com, www.bsstinsurancefordui.com, www.bewstinsurancefordui.com, www.bwstinsurancefordui.com, www.berstinsurancefordui.com, www.brstinsurancefordui.com, www.befstinsurancefordui.com, www.bfstinsurancefordui.com, www.bevstinsurancefordui.com, www.bvstinsurancefordui.com, www.becstinsurancefordui.com, www.bcstinsurancefordui.com, www.beqstinsurancefordui.com, www.bqstinsurancefordui.com, www.beastinsurancefordui.com, www.bastinsurancefordui.com, www.beystinsurancefordui.com, www.bystinsurancefordui.com, www.betinsurancefordui.com, www.besetinsurancefordui.com, www.beetinsurancefordui.com, www.beswtinsurancefordui.com, www.bewtinsurancefordui.com, www.besdtinsurancefordui.com, www.bedtinsurancefordui.com, www.besxtinsurancefordui.com, www.bextinsurancefordui.com, www.besftinsurancefordui.com, www.beftinsurancefordui.com, www.besgtinsurancefordui.com, www.begtinsurancefordui.com, www.besttinsurancefordui.com, www.bettinsurancefordui.com, www.besinsurancefordui.com, www.bestqinsurancefordui.com, www.besqinsurancefordui.com, www.bestainsurancefordui.com, www.besainsurancefordui.com, www.best insurancefordui.com, www.bes insurancefordui.com, www.bestwinsurancefordui.com, www.beswinsurancefordui.com, www.besteinsurancefordui.com, www.beseinsurancefordui.com, www.bestzinsurancefordui.com, www.beszinsurancefordui.com, www.bestxinsurancefordui.com, www.besxinsurancefordui.com, www.bestcinsurancefordui.com, www.bescinsurancefordui.com, www.bestnsurancefordui.com, www.bestirnsurancefordui.com, www.bestrnsurancefordui.com, www.bestifnsurancefordui.com, www.bestfnsurancefordui.com, www.bestivnsurancefordui.com, www.bestvnsurancefordui.com, www.bestiknsurancefordui.com, www.bestknsurancefordui.com, www.besti,nsurancefordui.com, www.best,nsurancefordui.com, www.bestibnsurancefordui.com, www.bestbnsurancefordui.com, www.bestignsurancefordui.com, www.bestgnsurancefordui.com, www.bestitnsurancefordui.com, www.besttnsurancefordui.com, www.bestiynsurancefordui.com, www.bestynsurancefordui.com, www.bestiunsurancefordui.com, www.bestunsurancefordui.com, www.bestijnsurancefordui.com, www.bestjnsurancefordui.com, www.bestimnsurancefordui.com, www.bestmnsurancefordui.com, www.bestinnsurancefordui.com, www.bestnnsurancefordui.com, www.bestisurancefordui.com, www.bestinnsurancefordui.com, www.bestinsurancefordui.com, www.bestinhsurancefordui.com, www.bestihsurancefordui.com, www.bestinjsurancefordui.com, www.bestijsurancefordui.com, www.bestinksurancefordui.com, www.bestiksurancefordui.com, www.bestinlsurancefordui.com, www.bestilsurancefordui.com, www.bestin surancefordui.com, www.besti surancefordui.com, www.bestinurancefordui.com, www.bestinseurancefordui.com, www.bestineurancefordui.com, www.bestinswurancefordui.com, www.bestinwurancefordui.com, www.bestinsdurancefordui.com, www.bestindurancefordui.com, www.bestinsxurancefordui.com, www.bestinxurancefordui.com, www.bestinsfurancefordui.com, www.bestinfurancefordui.com, www.bestinsgurancefordui.com, www.bestingurancefordui.com, www.bestinsturancefordui.com, www.bestinturancefordui.com, www.bestinsrancefordui.com, www.bestinsuwrancefordui.com, www.bestinswrancefordui.com, www.bestinsuerancefordui.com, www.bestinserancefordui.com, www.bestinsusrancefordui.com, www.bestinssrancefordui.com, www.bestinsuarancefordui.com, www.bestinsarancefordui.com, www.bestinsuancefordui.com, www.bestinsuriancefordui.com, www.bestinsuiancefordui.com, www.bestinsuroancefordui.com, www.bestinsuoancefordui.com, www.bestinsurlancefordui.com, www.bestinsulancefordui.com, www.bestinsurlancefordui.com, www.bestinsulancefordui.com, www.bestinsur.ancefordui.com, www.bestinsu.ancefordui.com, www.bestinsurncefordui.com, www.bestinsuraoncefordui.com, www.bestinsuroncefordui.com, www.bestinsurapncefordui.com, www.bestinsurpncefordui.com, www.bestinsura9ncefordui.com, www.bestinsur9ncefordui.com, www.bestinsurancefordui.com, www.bestinsurncefordui.com, www.bestinsuraincefordui.com, www.bestinsurincefordui.com, www.bestinsurauncefordui.com, www.bestinsuruncefordui.com,

Other websites we recently analyzed

  1. گیم آوا
    گیم آوا مرکز فروش بازی در ایران » فروش بازی کامپیوتری ، فروش بازی ایکس باکس 360 و One ، فروش بازی پلی استیشن 1 - 2 - 3 - 4 ، فروش بازی پی اس پی ، خرید اینترنتی بازی در فروشگاه اینترنتی گیم آوا
    Iran, Islamic Republic of - 95.38.60.24
    Server software: nginx
    Technology: CSS, Html, Iframe
    Number of Javascript: 1
    Number of meta tags: 3
  2. 12345.net.cn
    Fremont (United States) - 184.105.178.89
    Server software: Tengine/1.4.2
    Technology: Google Adsense, Html, Javascript, Php
    Number of Javascript: 2
    Number of meta tags: 1
  3. newyorkmedicalmalpracticelawyer.net
    Dover (United States) - 192.230.92.93
    Server software:
    Technology: Html, Iframe, Incapsula, Javascript
    Number of Javascript: 1
    Number of meta tags: 4
  4. COBILIGHT Willkommen bei der COBILIGHT Vertrieb GmbH
    Sparen Sie ab sofort Stromkosten und wechseln Sie mit COBILight Vertriebs GmbH auf umweltschonende und energieeffiziente Beleuchtungssysteme!
    Germany - 5.9.101.99
    Server software: Apache
    Technology: CSS, Google Font API, Html, Javascript, Php, Google +1 Button
    Number of Javascript: 6
    Number of meta tags: 13
  5. tatutaao.com
    Beijing (China) - 117.79.148.162
    Server software: Apache/2
    Technology: Html
  6. dawsonvilledoctor.com
    New York (United States) - 69.172.201.153
    Server software: DOSarrest
    Technology: Html, Javascript
    Number of meta tags: 1
  7. Guda
    Slovenia - 91.240.216.11
    Server software: Apache
    Technology: CSS, Google Font API, Html, Html5, jQuery, Php, Pingback, Wordpress
    Number of Javascript: 6
    Number of meta tags: 4
  8. www.885509.net
    Kowloon (Hong Kong) - 123.1.156.80
    Server software: nginx/1.0.15
    Technology: CSS, Html, Javascript, Php
    Number of Javascript: 1
    Number of meta tags: 1
  9. Peering Exchange Hub India | Internet Exchange Point | Mumbai CH
    Mumbai CH is India's largest peering hub, offering neutral internet and peering exchange services through various traffic exchange points. Contact Us Now!
    Mumbai (India) - 206.183.111.214
    G Analytics ID: UA-79664070-1
    Server software: Microsoft-IIS/7.5
    Technology: CSS, Html, Javascript, Php, Google Analytics, Facebook Box, Google +1 Button
    Number of Javascript: 4
    Number of meta tags: 3
  10. Lanisky Data Center
    Scottsdale (United States) - 107.180.41.43
    Server software: Apache/2.4.18
    Technology: CSS, Html, Javascript
    Number of Javascript: 1
    Number of meta tags: 2

Check Other Websites